Ralstonia wenshanensis: KOL96_01165 Help Entry KOL96_01165       CDS       T08691                                  Name (GenBank) H-NS histone family protein   KO K03746   DNA-binding protein H-NS Organism rwe  Ralstonia wenshanensis Brite KEGG Orthology (KO) [BR:rwe00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:rwe03036]     KOL96_01165    03400 DNA repair and recombination proteins [BR:rwe03400]     KOL96_01165 Chromosome and associated proteins [BR:rwe03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     KOL96_01165 DNA repair and recombination proteins [BR:rwe03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       KOL96_01165 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_HNS Histone_HNS_N Motif Other DBs NCBI-ProteinID:  UGS88890 LinkDB All DBs Position p56D2:267334..267603 Genome browser AA seq 89 aa AA seqDB search MKEGHPPEPGREAAIAWILEQMQTYDLSVDDLQAHGCFDAPPPPPAPAAPIGPVYMSADG QHWDGSGDMPDWLQRAVNAGQSIEHFRVG NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaaggaaggtcacccgccggagccgggtcgcgaagccgcgatcgcctggatcctggaa caaatgcagacgtacgacctgtctgtcgacgatttgcaggcacatggctgctttgacgcg ccaccgccgccgcccgcaccagccgctcccatcggccccgtctacatgagcgccgacggt caacactgggacggctccggcgacatgccagactggctgcaacgcgccgtcaacgccgga cagagcatcgagcatttccgcgtgggctga

DBGET integrated database retrieval system