Ralstonia wenshanensis: KOL96_12625 Help Entry KOL96_12625       CDS       T08691                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism rwe  Ralstonia wenshanensis Pathway rwe01100   Metabolic pathways rwe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:rwe00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KOL96_12625 (acpP)    00074 Mycolic acid biosynthesis     KOL96_12625 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KOL96_12625 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L50 DUF1896 Motif Other DBs NCBI-ProteinID:  UGS91928 LinkDB All DBs Position 1018430..1018669 Genome browser AA seq 79 aa AA seqDB search MDNIDARVKKIVAEQLGVAEADIKNESSFVNDLGADSLDTVELVMALEDEFGMEIPDEEA EKITTVQQAIDYATAHVKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggacaacatcgacgcacgcgttaagaagatcgttgcagagcaactcggcgtggccgaa gcagacatcaagaacgaatcgtcgttcgtgaacgatctgggcgcggattcgctcgatacg gttgagctggtgatggctctggaagacgagttcggtatggaaatcccggacgaagaagcc gagaagatcaccacggtgcagcaagccatcgattacgcgaccgcccacgtcaaggcgtaa

DBGET integrated database retrieval system