Rubrobacter xylanophilus: Rxyl_2495 Help Entry Rxyl_2495         CDS       T00368                                  Name (GenBank) sarcosine oxidase subunit D   KO K00304   sarcosine oxidase, subunit delta [EC:1.5.3.24 1.5.3.1] Organism rxy  Rubrobacter xylanophilus Pathway rxy00260   Glycine, serine and threonine metabolism rxy01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:rxy00001]  09100 Metabolism   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     Rxyl_2495 Enzymes [BR:rxy01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.3  With oxygen as acceptor     1.5.3.1  sarcosine oxidase (formaldehyde-forming)      Rxyl_2495     1.5.3.24  sarcosine oxidase (5,10-methylenetetrahydrofolate-forming)      Rxyl_2495 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  SoxD Motif Other DBs NCBI-ProteinID:  ABG05419 UniProt:  Q1AT59 LinkDB All DBs Position 2508857..2509123 Genome browser AA seq 88 aa AA seqDB search MKILNCPINGPRPIHEFIYGGEFRDMPDVDAVTDGEWVDYLYNRSGVPGIKREWWYHVAS NVWFIAERDTATNVVCKTYLFEGRRNYE NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaagatattaaactgcccaatcaatggtccacgtccaattcatgagtttatttatggc ggagagtttcgggatatgcctgatgtagatgctgtaacagacggagagtgggtagattat ctctataaccgcagtggggttcctgggattaaacgggagtggtggtatcacgttgccagc aatgtttggtttattgctgaacgggatacagcgacgaatgttgtgtgcaaaacctacttg tttgagggtagaagaaactatgagtag

DBGET integrated database retrieval system