KEGG   Rubrobacter xylanophilus: Rxyl_2847
Entry
Rxyl_2847         CDS       T00368                                 
Name
(GenBank) aspartate carbamoyltransferase
  KO
K24871  ureidoglycine carbamoyltransferase [EC:2.1.3.16]
Organism
rxy  Rubrobacter xylanophilus
Pathway
rxy00230  Purine metabolism
rxy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rxy00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Rxyl_2847
Enzymes [BR:rxy01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.16  ureidoglycine carbamoyltransferase
     Rxyl_2847
SSDB
Motif
Pfam: OTCace_N OTCace
Other DBs
NCBI-ProteinID: ABG05759
UniProt: Q1AS69
LinkDB
Position
2853074..2854093
AA seq 339 aa
MQKEAVRDAANLPSIRSLVRAVGFEGRSLHSINDLTNDQIYALFELARALEPFHRSSVDL
LRGSVMVTLFFQPSTRTRMSFETAMHRLGGAVVTEANPLVSSSAAKEESLADTMRTISKY
ANVIVLRHPDDVAAREGASYSESPVINGGWGDWEHPTQALLDLYTLWRTHGGVEGAKVVV
ATPDMVHARTGHSMAYGLARLGAEVTLASRSDYRAPEEVIEGLRRVEGAKVREVFDLDQD
GFNDLVSEMDLVYLPGCSAPKGEAAEEFKKMMDEYYVRLETLEKVRESEGRIIRVTHTLP
RRPGEMDLRIDDTPHQQYFEAIAYSVAIRMALVAAIVGA
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgcagaaagaggcggtaagggacgcggcgaacctgccctccatccgctcgctcgtgcgg
gcggtgggcttcgagggcagaagcctccactccataaacgacctgacgaacgaccagatc
tacgcgctcttcgagctcgcccgggccctcgagcccttccaccgctcctcggtggacctc
ttgcgcggcagcgtgatggtcaccctcttcttccagccgagcacccgcacccggatgagc
ttcgagaccgcgatgcaccggctcggcggggccgtcgtgaccgaggcgaacccgctcgtc
tcctcctcggcggccaaggaggagtcgctcgccgacacgatgcgcaccatctccaagtac
gccaacgtgatcgtgctgcgccacccggacgacgtcgccgcgcgcgagggggcctcctac
tccgagtcccccgtcataaacggcggctggggcgactgggagcaccccacgcaggcgctc
ctggacctctacaccctctggcgcacccacggcggcgtcgagggggcgaaggtcgtggtc
gccaccccggacatggtccacgcccgcaccgggcactcgatggcctacgggctcgcccgg
ctcggggccgaggtgacgctcgcctcccgcagtgactaccgggcccccgaggaggtgatc
gagggcctgcgccgggtcgagggggcgaaggtgcgggaggtcttcgacctcgaccaggac
ggcttcaacgacctcgtctcggagatggacctcgtctacctgccgggctgcagcgccccc
aagggcgaggccgccgaggagttcaagaagatgatggacgagtactacgtccggctcgag
acgctcgagaaggtgcgcgagagcgagggccgcatcatccgggtcacccacaccctcccg
cgccgcccgggcgagatggacctgcgcatcgacgacaccccccaccagcagtacttcgag
gcgatagcctacagcgtcgcgatccggatggccctcgtcgccgctatcgtgggggcgtag

DBGET integrated database retrieval system