KEGG   Sphingomonas sp. AAP5: E2E30_05635
Entry
E2E30_05635       CDS       T10507                                 
Symbol
rodA
Name
(GenBank) rod shape-determining protein RodA
  KO
K05837  peptidoglycan glycosyltransferase [EC:2.4.99.28]
Organism
saap  Sphingomonas sp. AAP5
Pathway
saap00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:saap00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    E2E30_05635 (rodA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:saap01003]
    E2E30_05635 (rodA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:saap01011]
    E2E30_05635 (rodA)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:saap03036]
    E2E30_05635 (rodA)
Enzymes [BR:saap01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.28  peptidoglycan glycosyltransferase
     E2E30_05635 (rodA)
Glycosyltransferases [BR:saap01003]
 Polysaccharide
  Bacterial polysaccharide (excluding LPS)
   E2E30_05635 (rodA)
Peptidoglycan biosynthesis and degradation proteins [BR:saap01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase
   E2E30_05635 (rodA)
Chromosome and associated proteins [BR:saap03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    E2E30_05635 (rodA)
SSDB
Motif
Pfam: FTSW_RODA_SPOVE DUF6264
Other DBs
NCBI-ProteinID: QBM75294
LinkDB
Position
complement(1239748..1240866)
AA seq 372 aa
MSGLSFVPAPLAQLPWKILLLVLAIGCFDSLVLYSAAGGSIRPWALSQGIRFFVFLSGAI
VLSRIPERVWSNAALPAYGALCVMLVLVELVGAIRGGGQRWLDLGIGFRLQPSELMKPCI
VLTCAKFYDLLPPNETRRFGAIWPAALLILVPAALVMKQPDLGTALMIMIGGITVMFLAG
VPLRLFIGGALALGAAVPLAVNFVLHGYQRNRILVFLDPESDPLGIGYHISQSKIAIGSG
GIFGKGFLNGTQSHLDYLPEGHTDFALATMMEEWGLVGGVLLIIAFLVIVQWGLSTAMQA
QSRFAKLTAAGLAATIFYYVSINMAMVMGMAPVVGVPLPLISNGGSSQMTFMLCLGILMS
IDRTNRRSPVRW
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgagcggtctgagtttcgtccctgccccgctcgcgcaattgccgtggaagattctgctg
ctcgtcctcgcgatcggctgtttcgattcgctcgtgctctattcggcggcgggcggcagc
attcgcccctgggcgctgtcgcaaggcatccgcttcttcgtcttcctcagcggcgcgatc
gtgctgtcgcgcatccctgagcgggtgtggagcaatgccgcgctccctgcttatggcgcg
ctgtgcgtgatgctcgtgctcgtcgaactcgtcggtgcgatccgcggcggcggacagcgc
tggctcgatctcgggatcggcttccggctccagccgtccgagctgatgaagccgtgcatc
gtgctgacctgcgccaaattctacgatctgctgccgcccaacgagacgcggcgcttcggc
gcgatctggcccgcggcgctgctgatcctggttcctgcggcgctggtgatgaagcaaccc
gacctcggtaccgcattgatgatcatgatcggcggcatcaccgtgatgttcctcgcaggc
gtgccgctccgcctgttcatcggcggcgcgctcgcgctcggcgcggcggttccgctcgcg
gtcaatttcgtgctgcacggctatcagcgcaaccgcatcctggtgtttctcgaccccgaa
agcgatccgctcgggatcggctaccatatcagccagtcgaagatcgcgatcggatcgggc
gggatcttcggcaaaggcttcctcaacggtacgcaaagccatctcgattacctgcccgag
gggcataccgatttcgcgctcgcgacgatgatggaggaatgggggctggtcggcggcgtg
ttgctgatcatcgcgttcctcgtgatcgtgcaatggggtctgtcgaccgcgatgcaggcg
caatcgcgcttcgccaagctgaccgcggccgggcttgccgcgacgatcttctattatgtt
tcgatcaacatggcgatggtgatggggatggcgccggtggtcggcgtgccgctgccgctg
atcagcaacggcggatcgagccagatgaccttcatgctgtgcctcgggattctgatgtcg
atcgaccggaccaatcgccgttcgccggtgcgctggtag

DBGET integrated database retrieval system