Sphingomonas sp. AAP5: E2E30_20135 Help Entry E2E30_20135       CDS       T10507                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism saap  Sphingomonas sp. AAP5 Brite KEGG Orthology (KO) [BR:saap00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:saap03032]     E2E30_20135    03036 Chromosome and associated proteins [BR:saap03036]     E2E30_20135    03400 DNA repair and recombination proteins [BR:saap03400]     E2E30_20135 DNA replication proteins [BR:saap03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     E2E30_20135 Chromosome and associated proteins [BR:saap03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     E2E30_20135 DNA repair and recombination proteins [BR:saap03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       E2E30_20135 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_euk_1 Motif Other DBs NCBI-ProteinID:  QBM78184 UniProt:  A0A4P6XCD3 LinkDB All DBs Position p150:complement(82056..82325) Genome browser AA seq 89 aa AA seqDB search MNIGELAKGVAGTTGTSEAEAKAATAAVFDQIASAAAKGEEVSIAGFGKFSVKDRPERQG RNPSTGEAITIAASKKVSFTPAKGLKDKL NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgaacatcggtgaactggcgaagggcgtcgctgggacgacaggcacgagcgaggccgag gccaaggccgcaaccgccgccgtgttcgaccagatcgcaagcgcggccgcaaaaggcgaa gaagtctcgatcgccggcttcggcaagttctcggtcaaggatcgtcctgagcgccagggc cgcaatccgtcgaccggcgaggcgataacgatcgctgcatcgaagaaggtctcgttcaca cccgccaagggtctgaaggacaagctctaa

DBGET integrated database retrieval system