Staphylococcus aureus RF122: SAB1096 Help Entry SAB1096           CDS       T00303                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sab  Staphylococcus aureus RF122 Pathway sab00998   Biosynthesis of various antibiotics sab01100   Metabolic pathways sab01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sab00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SAB1096 (acpP)    00074 Mycolic acid biosynthesis     SAB1096 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SAB1096 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  CAI80785 UniProt:  Q2YXI4 LinkDB All DBs Position 1183276..1183509 Genome browser AA seq 77 aa AA seqDB search MENFDKVKDIIVDRLGVDADKVTEDASFKDDLGADSLDIAELVMELEDEFGTEIPDEEAE KINTVGDAVKFINSLEK NT seq 234 nt NT seq  +upstreamnt  +downstreamnt gtggaaaatttcgataaagtaaaagatatcatcgttgaccgtttaggtgtagacgctgat aaagtaactgaagatgcatctttcaaagatgatttaggcgctgactcacttgatatcgct gaattagtaatggaattagaagacgagtttggtactgaaattcctgatgaagaagctgaa aaaatcaacactgttggtgatgctgttaaatttattaacagtcttgaaaaataa

DBGET integrated database retrieval system