Streptomyces albidocamelliae: N8I86_13240 Help Entry N8I86_13240       CDS       T10602                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sabd  Streptomyces albidocamelliae Pathway sabd00998   Biosynthesis of various antibiotics sabd01100   Metabolic pathways sabd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sabd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     N8I86_13240    00074 Mycolic acid biosynthesis     N8I86_13240   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     N8I86_13240 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  UXY35626 LinkDB All DBs Position 2844300..2844548 Genome browser AA seq 82 aa AA seqDB search MAATQEEIVAGLAEIVNEIAGIPTEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDATDYILKHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactcaggaagagatcgtcgccggtctcgccgagatcgtgaacgagatcgcc gggatccccaccgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaggagcgcttcgacgtgaagatcccg gacgaggacgtcaagaacctcaagacggtcggcgacgcgaccgactacatcctcaagcac caggcctga

DBGET integrated database retrieval system