KEGG   Streptomyces albidocamelliae: N8I86_16875
Entry
N8I86_16875       CDS       T10602                                 
Symbol
rpmJ
Name
(GenBank) 50S ribosomal protein L36
  KO
K02919  large subunit ribosomal protein L36
Organism
sabd  Streptomyces albidocamelliae
Pathway
sabd03010  Ribosome
Brite
KEGG Orthology (KO) [BR:sabd00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    N8I86_16875 (rpmJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sabd03011]
    N8I86_16875 (rpmJ)
Ribosome [BR:sabd03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    N8I86_16875 (rpmJ)
  Bacteria
    N8I86_16875 (rpmJ)
SSDB
Motif
Pfam: Ribosomal_L36
Other DBs
NCBI-ProteinID: UXY36265
UniProt: A0ABY6EPE4
LinkDB
Position
complement(3680552..3680665)
AA seq 37 aa
MKVKPSVKKICDKCRVIRRHGRVMVICDNPRHKQRQG
NT seq 114 nt   +upstreamnt  +downstreamnt
atgaaggtcaagccgagcgtcaagaagatctgcgacaagtgcagggtgatccgccgtcac
ggtcgggtcatggtcatctgcgacaacccgcgccacaagcagcgccagggctga

DBGET integrated database retrieval system