Saccharibacillus brassicae: FFV09_23180 Help Entry FFV09_23180       CDS       T06082                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism saca  Saccharibacillus brassicae Pathway saca02024   Quorum sensing saca03018   RNA degradation Brite KEGG Orthology (KO) [BR:saca00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     FFV09_23180 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     FFV09_23180 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:saca03019]     FFV09_23180 (hfq)    03036 Chromosome and associated proteins [BR:saca03036]     FFV09_23180 (hfq) Messenger RNA biogenesis [BR:saca03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      FFV09_23180 (hfq) Chromosome and associated proteins [BR:saca03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     FFV09_23180 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 DUF150_C Motif Other DBs NCBI-ProteinID:  QDH23509 UniProt:  A0A4Y6V0F2 LinkDB All DBs Position complement(5505735..5505977) Genome browser AA seq 80 aa AA seqDB search MNKSINIQDTFLNQLRKENIPATVYLTNGFQIRGTIKAFDNFTIVIDSDGRQQMVYKHAI STFMPQRNVSLAQPDSTSGE NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgaacaaatccattaatattcaagacacgttcctgaaccaactgcgcaaagagaatatc cctgccacggtctatctgaccaacggatttcagattcggggcacgatcaaggctttcgat aacttcacgatcgtgatcgacagcgacggacgccagcagatggtgtacaagcacgccatt tcgacgtttatgccgcagcgcaacgtatccctcgcccagcccgacagcacgtccggcgaa taa

DBGET integrated database retrieval system