Sulfodiicoccus acidiphilus: HS1genome_0854 Help Entry HS1genome_0854    CDS       T05813                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism sacd  Sulfodiicoccus acidiphilus Pathway sacd03010   Ribosome Brite KEGG Orthology (KO) [BR:sacd00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     HS1genome_0854   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     HS1genome_0854  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:sacd03011]     HS1genome_0854    04121 Ubiquitin system [BR:sacd04121]     HS1genome_0854 Ribosome [BR:sacd03011]  Ribosomal proteins   Eukaryotes    Large subunit     HS1genome_0854   Archaea     HS1genome_0854 Ubiquitin system [BR:sacd04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    HS1genome_0854 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e HypA Zn_ribbon_3 DUF7577 DZR Zn_ribbon_LapB Ezh2_MCSS zinc_ribbon_6 Zn_ribbon_HMPTM zf-tcix DUF3053 Motif Other DBs NCBI-ProteinID:  BBD72465 UniProt:  A0A348B2R3 LinkDB All DBs Position 818026..818232 Genome browser AA seq 68 aa AA seqDB search MNSSLNNLARSVMPLTDPAQVQIVYNRVFAKKVCRECGALNSIRAVKCRRCHSYNLRPKK KEIASKKS NT seq 207 nt NT seq  +upstreamnt  +downstreamnt ttgaactcctccctaaataatttagctaggtccgtcatgccactaaccgatccagcgcaa gtccaaattgtttacaacagggtgttcgcgaagaaagtatgcagagagtgtggagccctg aactctatcagggcggtgaagtgtaggaggtgtcatagctacaacctcagaccaaagaag aaggagatagcgagcaagaagtcctaa

DBGET integrated database retrieval system