KEGG   Saccharopolyspora sp. ASAGF58: FDZ84_19670
Entry
FDZ84_19670       CDS       T06538                                 
Name
(GenBank) EamA family transporter
  KO
K15269  probable blue pigment (indigoidine) exporter
Organism
sacg  Saccharopolyspora sp. ASAGF58
Brite
KEGG Orthology (KO) [BR:sacg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sacg02000]
    FDZ84_19670
Transporters [BR:sacg02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   FDZ84_19670
SSDB
Motif
Pfam: EamA
Other DBs
NCBI-ProteinID: QIZ36482
LinkDB
Position
complement(4099306..4100226)
AA seq 306 aa
MNQTTSGSGSTAARTALTALAPMVWGTTYVVTTELLPPGNPMSAGLLRALPAGLIALVIT
RTLPNGTWWAKAAVLGVLNIGMFFPLLFVAAESLPGGVAATLAAAQPLIVAVLAVTVLGE
HPSAWRFGWGVVGVLGVGLVVIGPDAAFDVPGILAGLAGAASMALGVTLTKRWGRPAEAS
PTAFAGWQLTAGGLFLLPVTFLFEGPPPAIDGTAALGYLWLGLVGGLAAYVLWFRGITTL
PVTSVALLGLLSPMAAALLGVLLLDQMLGPIQLLGFALSLAAIAAGQFSPRTRSPLPNLT
AQRTAR
NT seq 921 nt   +upstreamnt  +downstreamnt
atgaaccagacgacctccggcagcgggagcactgcagcccgcacagcgctgacggcgctc
gcgcccatggtgtggggcacgacctacgtggtcaccaccgagctcctacccccaggaaat
cccatgtccgcagggcttctgcgcgcgttgcccgcagggctgatcgctttggtgatcacg
cggaccctgccgaacgggacgtggtgggcgaaggcggcggtgctcggcgtgctgaacata
gggatgttcttcccactgctgttcgtggcggccgaaagcctgccaggaggcgttgccgcc
acgctggctgcggcccagccgctcatcgtggcagtcctggcagtgaccgtcctcggcgag
catccttcggcttggcgcttcggctggggggtggtcggtgtactgggcgtcggcctagtg
gtgatcggtccggatgcggcgttcgacgtccccgggatcctggcgggcctggcgggcgcg
gcatcgatggcgctgggggtaacgctaaccaagcggtggggtcgtcctgcggaagccagc
cccaccgcgttcgccggctggcaactcaccgccggcggtcttttcctcctgcccgtcacg
ttcctgttcgaggggccaccgcccgcgatcgacgggacggccgcgctcggctacctctgg
ctgggcctggtcggcggtttggccgcctacgtcttgtggttccgcggcatcaccacgttg
ccggtcacctcggtcgccctcctcggcctgttgtcgccgatggctgctgcgctactcgga
gtcctcctgctcgatcagatgctcggcccgatccaactgctcggcttcgcgctctcgctc
gccgcaatcgccgcaggccagttctcgccgcgaacccgctccccacttccgaacctcacc
gcgcaaaggactgctcgatga

DBGET integrated database retrieval system