Sulfolobus acidocaldarius N8: SacN8_04135 Help Entry SacN8_04135       CDS       T02452                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism sacn  Sulfolobus acidocaldarius N8 Pathway sacn03010   Ribosome Brite KEGG Orthology (KO) [BR:sacn00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     SacN8_04135   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     SacN8_04135  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:sacn03011]     SacN8_04135    04121 Ubiquitin system [BR:sacn04121]     SacN8_04135   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sacn04147]     SacN8_04135 Ribosome [BR:sacn03011]  Ribosomal proteins   Eukaryotes    Small subunit     SacN8_04135   Archaea     SacN8_04135 Ubiquitin system [BR:sacn04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    SacN8_04135 Exosome [BR:sacn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    SacN8_04135   Exosomal proteins of colorectal cancer cells    SacN8_04135 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_IS1595 Zn_ribbon_SprT Zn_ribbon_RPB9 Cas12f1-like_TNB TackOD1 Med16_C Zn_ribbon_Nudix NRDD Zn_ribbon_PriA zf-tcix YhfH YPEH2ZP DUF5816 Zn_ribbon_8 Zn_ribbon_3 DZR Motif Other DBs NCBI-ProteinID:  AGE70798 UniProt:  M1I3J1 LinkDB All DBs Position complement(684787..684981) Genome browser AA seq 64 aa AA seqDB search MPKNNNENQSKAVVRTYYEVEQDSIKLKNKKCPRCGSIMAHHMKPLERWACGKCGYTEFI GKSR NT seq 195 nt NT seq  +upstreamnt  +downstreamnt gtgcccaaaaacaacaatgaaaatcaatctaaagctgtagtaagaacttattacgaagta gaacaagattcaataaagctaaagaataaaaaatgtcctagatgcggcagtatcatggct catcacatgaagcctctggaacgatgggcatgcggtaaatgtggctataccgaatttata ggtaaatccagatga

DBGET integrated database retrieval system