Sulfolobus acidocaldarius SUSAZ: SUSAZ_02665 Help Entry SUSAZ_02665       CDS       T02975                                  Name (GenBank) ribonuclease P   KO K03538   ribonuclease P protein subunit POP4 [EC:3.1.26.5] Organism sacs  Sulfolobus acidocaldarius SUSAZ Pathway sacs03008   Ribosome biogenesis in eukaryotes Brite KEGG Orthology (KO) [BR:sacs00001]  09120 Genetic Information Processing   09122 Translation    03008 Ribosome biogenesis in eukaryotes     SUSAZ_02665  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03009 Ribosome biogenesis [BR:sacs03009]     SUSAZ_02665    03016 Transfer RNA biogenesis [BR:sacs03016]     SUSAZ_02665    03029 Mitochondrial biogenesis [BR:sacs03029]     SUSAZ_02665 Enzymes [BR:sacs01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.26  Endoribonucleases producing 5'-phosphomonoesters     3.1.26.5  ribonuclease P      SUSAZ_02665 Ribosome biogenesis [BR:sacs03009]  Eukaryotic type   Pre-60S particles    RNases     RNase MRP      SUSAZ_02665 Transfer RNA biogenesis [BR:sacs03016]  Eukaryotic type   5'processing factors    Ribonucrease P     SUSAZ_02665 Mitochondrial biogenesis [BR:sacs03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial transcription and translation factors    RNase MRP     SUSAZ_02665 SSDB OrthologParalogGFIT Motif Pfam:  RNase_P-MRP_p29 CshA_repeat NUMOD4 Motif Other DBs NCBI-ProteinID:  AHC50995 LinkDB All DBs Position complement(441757..441996) Genome browser AA seq 79 aa AA seqDB search MDFIGSRVKILNHTDPTLVGKEGLVIKDTENAFMIGSNSKKILVIKQNGLFQISTKGKIF VVPGTKLIGKPEKRGYKFG NT seq 240 nt NT seq  +upstreamnt  +downstreamnt ttggattttataggttcacgggtgaagatcttgaatcacactgatccaacattagttggg aaggaaggattggtgataaaagatacagagaatgcatttatgattggttctaattcaaag aaaattctagttattaagcaaaatggattatttcaaattagtacgaaaggtaaaattttt gttgtacctggcactaagctaataggtaaacctgaaaagaggggatataagtttgggtaa

DBGET integrated database retrieval system