Sulfolobus acidocaldarius SUSAZ: SUSAZ_03875 Help Entry SUSAZ_03875       CDS       T02975                                  Name (GenBank) 30S ribosomal protein S27   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism sacs  Sulfolobus acidocaldarius SUSAZ Pathway sacs03010   Ribosome Brite KEGG Orthology (KO) [BR:sacs00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     SUSAZ_03875   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     SUSAZ_03875  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:sacs03011]     SUSAZ_03875    04121 Ubiquitin system [BR:sacs04121]     SUSAZ_03875   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sacs04147]     SUSAZ_03875 Ribosome [BR:sacs03011]  Ribosomal proteins   Eukaryotes    Small subunit     SUSAZ_03875   Archaea     SUSAZ_03875 Ubiquitin system [BR:sacs04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    SUSAZ_03875 Exosome [BR:sacs04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    SUSAZ_03875   Exosomal proteins of colorectal cancer cells    SUSAZ_03875 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_IS1595 Zn_ribbon_RPB9 Cas12f1-like_TNB Zn_ribbon_SprT Med16_C NRDD TackOD1 Zn_ribbon_Nudix DUF5816 zf-tcix YPEH2ZP YhfH DZR Zn_ribbon_3 Zn_ribbon_8 Motif Other DBs NCBI-ProteinID:  AHC51199 LinkDB All DBs Position complement(634869..635072) Genome browser AA seq 67 aa AA seqDB search MVRVPKNNNENQSKAVVRTYYEIEQDSIKLKNKKCPRCGSIMAHHMKPLERWACGKCGYT EFIGKSR NT seq 204 nt NT seq  +upstreamnt  +downstreamnt gtggtaagagtgcccaaaaacaacaatgaaaatcaatctaaagctgtagtaagaacttat tatgaaatagaacaagattcaataaagctaaagaataaaaaatgtcctagatgcggtagt atcatggctcatcacatgaagcctttggagcgatgggcatgcggtaaatgtggctatacc gaatttataggtaaatccagatga

DBGET integrated database retrieval system