KEGG   Streptomyces actuosus: DMT42_19730
Entry
DMT42_19730       CDS       T08084                                 
Name
(GenBank) hypothetical protein
  KO
K14256  anhydrotetracycline 6-monooxygenase / 5a,11a-dehydrotetracycline 5-monooxygenase [EC:1.14.13.38 1.14.13.234]
Organism
sact  Streptomyces actuosus
Pathway
sact00253  Tetracycline biosynthesis
sact01057  Biosynthesis of type II polyketide products
sact01100  Metabolic pathways
sact01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sact00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    DMT42_19730
   00253 Tetracycline biosynthesis
    DMT42_19730
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:sact01008]
    DMT42_19730
Enzymes [BR:sact01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.38  anhydrotetracycline 6-monooxygenase
     DMT42_19730
    1.14.13.234  5a,11a-dehydrotetracycline 5-monooxygenase
     DMT42_19730
Polyketide biosynthesis proteins [BR:sact01008]
 Polyketide tailoring proteins
  Oxygenase
   DMT42_19730
SSDB
Motif
Pfam: FAD_binding_3 DAO Pyr_redox Pyr_redox_2 HI0933_like NAD_binding_8 Lycopene_cycl Amino_oxidase Trp_halogenase Pyr_redox_3 FAD_binding_2 ApbA TrkA_N
Other DBs
NCBI-ProteinID: AWT44317
UniProt: A0A2U9P446
LinkDB
Position
4199536..4201002
AA seq 488 aa
MVDVIVAGGGPVGLMLACELRLAGVDVLVLDRLAERVPHSKALGMHARTLEVLDQRGLVD
RFLEGHKRAPATHFAGLRPLEFDASDTRHPYMLLIPQAHTERLLAERAAELGVRIRYGTE
VTGLAQDADGVDVEVAGGERLRARFLAGCDGSRSTVRRLLGVGFPGTPATVTAMIADVSL
DEPPAQPRLLARYPGGQAGVLEYAPGRYRAMTIQYDTPYDPVADGDNPVTFEEFREVFRA
IAGTDHGMRDPLWVSRFGDAARQADRYRVGRVFLAGDAAHIHNPSGGQGLNLGMQDAVNL
GWKLAAVVRGQAPQELLDTYHDERHPVGARVLQNTHAQVALSRPGHAVDALRELFAELIR
IDEVNDRLTRMISALDVRYPVAGAHPLTGARMPDVDLKTADGDTRLYPLLHSGRGVLLDL
ADDAALRTTARGWADRVDLVPAHGADPRLDGVAAVLVRPDGHVAWAAPTDVTLPDALTTW
FGPARGTR
NT seq 1467 nt   +upstreamnt  +downstreamnt
atggtggacgtgatcgtcgcgggcggcggcccggtcggactgatgctggcgtgcgagctg
cggctggccggcgtggacgtgctggtgctggaccggctcgccgagcgcgtaccgcactcc
aaggcgctcggcatgcacgcgcggaccctggaggtgctggaccagcggggcctcgtggac
cgcttcctggagggccacaagcgggcgccggccacgcacttcgccgggctgcggccgctg
gagttcgacgcgtccgacacccggcacccgtacatgctgctcatcccgcaggcgcacacc
gagcggctgctcgccgagcgggccgccgagctgggcgtgcggatccggtacggcaccgag
gtcaccggcctcgcccaggacgccgacggcgtcgacgtcgaggtcgcgggaggtgagcgg
ctgcgggcgcggttcctggccggctgcgacggcagccgcagcacggtgcgccggctgctc
ggcgtgggcttccccggcacgccggccacggtcacggcgatgatcgccgacgtgtccctg
gacgagcccccggcccagccgaggctgctggcccgctacccgggcgggcaggccggggtg
ctggagtacgcgccgggccggtaccgggcgatgaccatccagtacgacaccccgtacgac
ccggtggccgacggggacaacccggtgaccttcgaggagttccgggaggtcttccgggcc
atcgccggcaccgaccacggcatgcgggacccgctgtgggtctcccggttcggcgacgcg
gcccggcaggccgaccgctaccgggtcggccgggtcttcctggcgggcgacgccgcgcac
atccacaacccgtccggcgggcagggcctgaacctcggcatgcaggacgcggtcaacctc
ggctggaagctggccgcggtggtgcgcgggcaggccccgcaggagctgctggacacgtac
cacgacgagcggcacccggtcggcgcgcgcgtcctgcagaacacgcacgcgcaggtcgcg
ctgagccggcccgggcacgcggtggacgcgctgcgcgagctgttcgccgagctgatccgc
atcgacgaggtgaacgaccggctcacccgcatgatcagcgccctcgacgtgcgctacccg
gtcgccggcgcccacccgctgaccggggcgcgcatgccggacgtggacctcaagacggcc
gacggtgacacgcgcctgtaccccctgctgcactccggccggggcgtgctgctcgacctc
gccgacgatgcggcgctgcgtacgaccgcccgcggctgggccgaccgcgtcgacctggtg
ccggcgcacggcgcggacccgcggctggacggggtggcggcggtgctggtgcggcccgac
ggccatgtggcgtgggcggcgccgaccgacgtgaccctgccggacgcgctgacgacctgg
ttcggcccggcgcgcgggacgcggtga

DBGET integrated database retrieval system