Streptomyces actuosus: DMT42_25815 Help Entry DMT42_25815       CDS       T08084                                  Name (GenBank) glutaredoxin-like protein   KO K18917   mycoredoxin [EC:1.20.4.3] Organism sact  Streptomyces actuosus Brite KEGG Orthology (KO) [BR:sact00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     DMT42_25815 Enzymes [BR:sact01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      DMT42_25815 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 GST_N_2 GST_N_3 Glrx-like Thioredoxin IU_nuc_hydro Motif Other DBs NCBI-ProteinID:  AWT45362 UniProt:  A0A2U9P754 LinkDB All DBs Position complement(5529806..5530048) Genome browser AA seq 80 aa AA seqDB search MPGTVTMYSTTWCGYCRRLKSQLDREGIAYTEINIEQDPESAAFVEKANGGNQTVPTVLF PDGSTLTNPSLAQVKQKIGA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgccgggcactgtgacgatgtacagcaccacgtggtgcggctactgccgccggctgaag agccagctggaccgcgagggcatcgcgtacaccgagatcaacatcgagcaggacccggag tccgcggcgttcgtggagaaggcgaatggcggaaaccagacggtgccgactgtgctcttc ccggacggctccacgctcacgaacccgtcgctggctcaggtgaagcagaagatcggcgcg taa

DBGET integrated database retrieval system