Sporomusa acidovorans: SPACI_015690 Help Entry SPACI_015690      CDS       T10566                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism sacv  Sporomusa acidovorans Pathway sacv00020   Citrate cycle (TCA cycle) sacv00720   Other carbon fixation pathways sacv01100   Metabolic pathways sacv01110   Biosynthesis of secondary metabolites sacv01120   Microbial metabolism in diverse environments sacv01200   Carbon metabolism sacv01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:sacv00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     SPACI_015690   09102 Energy metabolism    00720 Other carbon fixation pathways     SPACI_015690 Enzymes [BR:sacv01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      SPACI_015690 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_21 Fer4 Fer4_7 Fer4_2 Fer4_6 Fer4_10 LdpA_Fe-S-bd Fer4_4 Fer4_22 Fer4_9 Fer4_17 Fer4_15 Fer4_3 DUF4649 Fer4_8 Motif Other DBs NCBI-ProteinID:  XFO71539 UniProt:  A0ABZ3IZK3 LinkDB All DBs Position 1675843..1676049 Genome browser AA seq 68 aa AA seqDB search MMAKLEFSQERCKGCELCKVACPKKLIVMSSTFNGKGYNYATCPDDSECVGCCLCAKTCP DLVIKIYK NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atgatggcaaaactggaattttcccaggaaagatgcaaaggctgcgaattgtgtaaagtg gcatgccccaaaaagctgattgttatgtcgtcaacttttaatggcaaaggttacaattat gcaacctgtcccgatgattcggaatgtgtgggctgctgcctttgtgcaaaaacatgcccg gatttagtcattaagatttataaataa

DBGET integrated database retrieval system