Sporomusa acidovorans: SPACI_038070 Help Entry SPACI_038070      CDS       T10566                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism sacv  Sporomusa acidovorans Pathway sacv00020   Citrate cycle (TCA cycle) sacv00720   Other carbon fixation pathways sacv01100   Metabolic pathways sacv01110   Biosynthesis of secondary metabolites sacv01120   Microbial metabolism in diverse environments sacv01200   Carbon metabolism sacv01210   2-Oxocarboxylic acid metabolism Brite Enzymes [BR:sacv01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      SPACI_038070 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  XFO73700 LinkDB All DBs Position complement(3928016..3928228) Genome browser AA seq 70 aa AA seqDB search MSLKLHINRCKGCGICVEFCPKKVLGINQLEKVEVVNEQDCILCRQCEMRCPDYAIFVKK YKGDEYSVQS NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcttaaaattacacattaatcgttgcaagggttgtggtatttgtgtggagttttgc cccaagaaggtattgggtattaaccagcttgaaaaggtagaagttgttaatgaacaagac tgcattctgtgccgccagtgcgagatgcgctgcccggattatgcaattttcgtaaagaaa tacaagggagatgaatatagtgtccaaagttag

DBGET integrated database retrieval system