Sporomusa acidovorans: SPACI_041800 Help Entry SPACI_041800      CDS       T10566                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism sacv  Sporomusa acidovorans Pathway sacv01100   Metabolic pathways sacv01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sacv00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SPACI_041800    00074 Mycolic acid biosynthesis     SPACI_041800   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SPACI_041800 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Motif Other DBs NCBI-ProteinID:  XFO74071 UniProt:  A0ABZ3J7J6 LinkDB All DBs Position complement(4317078..4317323) Genome browser AA seq 81 aa AA seqDB search MIENKAFYEKFAEMLEISPAKVNEGLVLKDTSWDSLAVMATIAMIDDIYNVTVPGKKLSQ CQTAGDILALVQMETSKKADI NT seq 246 nt NT seq  +upstreamnt  +downstreamnt gtgatagaaaataaagcattttatgaaaaatttgcagagatgctagaaatctctccagca aaggttaatgaaggtctggtattaaaagatactagttgggattcattggcggtaatggcg actattgcgatgatagatgatatttataatgtaaccgttcctgggaaaaaattatcacaa tgtcaaacagctggagatatcttggctcttgtacaaatggaaacaagtaaaaaggcggac atataa

DBGET integrated database retrieval system