KEGG   Stenotrophomonas acidaminiphila: AOT14_09130
Entry
AOT14_09130       CDS       T04107                                 
Symbol
cysA
Name
(GenBank) sulfate ABC transporter ATP-binding protein
  KO
K02045  sulfate/thiosulfate transport system ATP-binding protein [EC:7.3.2.3]
Organism
sacz  Stenotrophomonas acidaminiphila
Pathway
sacz00920  Sulfur metabolism
sacz02010  ABC transporters
Module
sacz_M00616  Sulfate-sulfur assimilation
Brite
KEGG Orthology (KO) [BR:sacz00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    AOT14_09130 (cysA)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AOT14_09130 (cysA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sacz02000]
    AOT14_09130 (cysA)
Enzymes [BR:sacz01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.3  ABC-type sulfate transporter
     AOT14_09130 (cysA)
Transporters [BR:sacz02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Sulfate/thiosulfate transporter
    AOT14_09130 (cysA)
SSDB
Motif
Pfam: ABC_tran AAA_21 AAA_22 SMC_N TOBE_2 AAA_29 TOBE_3 AAA_16 AAA_28 SbcC_Walker_B NACHT AAA_23 nSTAND1 AAA_14 DLIC AAA AAA_30 RsgA_GTPase AAA_24 ORC-CDC6-like Rad17 CysA_C_terminal TsaE AAA_18 AAA_5 cobW nSTAND3 DO-GTPase2 AAA_25
Other DBs
NCBI-ProteinID: ALJ27344
UniProt: A0A0R0E515
LinkDB
Position
1023711..1024757
AA seq 348 aa
MNIRIQQLGKRFGAFPALDGVSLDIRSGELLALLGPSGSGKTTLLRALAGLEHPEQGRIL
FDGEDATGLSVQARRAGFVFQHYALFRHMDVRANIAFGLEVRRGERRWPRARIAARVEEL
LALVQLDGLGGRYPTQLSGGQRQRVALARALAIEPRVLLLDEPFGALDAQVRRDLRRWLR
ELHDRTGLTTVFVTHDQEEALELADRVAILNRGRIEQVGSPGEVYDRPVSPFVYGFVGEA
NRLPARTDGEVLEVAGARWPRPEGLPDQVPLDVYVRPEDMRVDDAGDWTGTVLAVQRSGA
RARLRARLRGAAVDVEVELPPDAPAYVAGQVVALAARRHGVFAAAATG
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgaacatccgcatccaacaactgggcaagcgcttcggcgcgtttcccgcgctcgacggc
gtcagcctggacatccgcagcggcgaactgctggcgctgctcgggccttccggctcgggc
aagaccaccctgctgcgcgcgctggccgggctggaacatcccgaacagggccggatcctg
ttcgacggcgaggacgccaccggcctgagcgtgcaggcgcgtcgcgccggcttcgtgttc
cagcactatgcgctgttccggcacatggacgtgcgcgccaacatcgccttcggcctggag
gtgcggcgcggcgagcggcgctggccgagggcgcgcatcgccgcgcgcgtcgaggagctg
ctggcgctggtgcagctcgacggcctgggcgggcgctatccgacgcagctgtccggcggc
cagcgccagcgcgtggcgctggcccgcgcgctggccatcgaaccgcgcgtgctgctgctg
gacgagccgttcggggcgctggatgcgcaggtgcgccgcgacctgcgccgctggctgcgc
gaactgcacgaccgcaccggcctgaccacggtgttcgtcacccacgaccaggaagaagcg
ctggagctggcggaccgcgtggcgatcctcaaccgcggccgcatcgaacaggtcggcagc
ccgggcgaggtctacgaccggccggtatcgcccttcgtctacggcttcgtcggcgaggcc
aatcgcctgccggcgcggaccgatggcgaggtgctggaggtggcgggtgcccgctggccg
cggccggagggcctgccggaccaggtcccgctggacgtctatgtgcgcccggaagacatg
cgcgtggacgatgccggcgactggacggggaccgtcctggcggtgcagcgcagcggggcc
agggcgcggttgcgggcgcggctgcgcggggccgcggtggacgtggaggtcgagctgccg
ccggacgcgccggcctatgtcgccgggcaggtcgttgcgctggcggcgcggcgccatggg
gtgttcgccgccgctgccacgggctag

DBGET integrated database retrieval system