Stenotrophomonas acidaminiphila: AOT14_16690
Help
Entry
AOT14_16690 CDS
T04107
Symbol
coaD
Name
(GenBank) phosphopantetheine adenylyltransferase
KO
K00954
pantetheine-phosphate adenylyltransferase [EC:
2.7.7.3
]
Organism
sacz
Stenotrophomonas acidaminiphila
Pathway
sacz00770
Pantothenate and CoA biosynthesis
sacz01100
Metabolic pathways
sacz01240
Biosynthesis of cofactors
Module
sacz_M00120
Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:
sacz00001
]
09100 Metabolism
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
AOT14_16690 (coaD)
Enzymes [BR:
sacz01000
]
2. Transferases
2.7 Transferring phosphorus-containing groups
2.7.7 Nucleotidyltransferases
2.7.7.3 pantetheine-phosphate adenylyltransferase
AOT14_16690 (coaD)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
CTP_transf_like
Motif
Other DBs
NCBI-ProteinID:
ALJ28057
UniProt:
A0A0R0DTA1
LinkDB
All DBs
Position
1849585..1850091
Genome browser
AA seq
168 aa
AA seq
DB search
MTQSNPRIAVYPGTFDPITNGHIDLVHRAAPLFEKIVVGVAQSPSKGPTLPLALRVELAR
EALARHDNVEVVGFDTLLAHFVRSMHAGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL
FLTPSEQHSFISSSLVREIARLGGDVSGFVPATVLEALRKARESRVGA
NT seq
507 nt
NT seq
+upstream
nt +downstream
nt
atgacccagtccaacccgcgcatcgccgtctatccaggcacgttcgacccgatcaccaac
ggtcacatcgacctggtgcaccgggccgcgccgctgttcgagaagatcgtggtcggcgtg
gcgcagagtccgtccaaggggccgacgctgccgctggcgctgcgcgtggaactggcgcgc
gaggcgctggcccggcatgacaacgtcgaggtggtgggtttcgacaccctgctggcgcat
ttcgtgcgctcgatgcatgccggggtactgctgcgcggcctgcgcgcggtgtccgatttc
gagtacgagttccagatggcgagcatgaaccgccacctgatcccggaggtcgagaccctg
ttcctgaccccatccgaacagcacagcttcatttcttcctcgctggtgcgcgaaatcgcc
cggctcggaggcgatgtgtccggcttcgtgccggccacggtgctggaagcgctgcgcaag
gcacgcgaatcccgcgtgggcgcctga
DBGET
integrated database retrieval system