Stenotrophomonas acidaminiphila: AOT14_19350 Help Entry AOT14_19350       CDS       T04107                                  Symbol flgM Name (GenBank) flgm   KO K02398   negative regulator of flagellin synthesis FlgM Organism sacz  Stenotrophomonas acidaminiphila Pathway sacz02020   Two-component system sacz02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:sacz00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     AOT14_19350 (flgM)  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     AOT14_19350 (flgM)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:sacz02035]     AOT14_19350 (flgM) Bacterial motility proteins [BR:sacz02035]  Flagellar system   Flagellar assembly proteins    Others     AOT14_19350 (flgM) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM Motif Other DBs NCBI-ProteinID:  ALJ28312 UniProt:  A0A0S1AZU2 LinkDB All DBs Position complement(2134038..2134340) Genome browser AA seq 100 aa AA seqDB search MSQKIDGGITASAQLRPLATPAKAAPAGSGETRPVEAADSVRLTGEATSLQAMQRELSAA PAIDTARVQAVREALENGSYQINPDAIAKRMLDLDGQLQA NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgagccagaaaatcgacggcgggatcacggcaagcgcccagttgcgcccgctcgccacg cccgccaaggccgcccccgccggtagcggcgagacccgtccggtcgaggccgccgacagc gtgcgcctgaccggcgaagccaccagcctgcaggccatgcagcgcgaactgtccgccgcc ccggcgatcgacaccgcgcgcgtgcaggccgtccgcgaagcactggagaacggcagctac cagatcaacccggacgccatcgccaagcgcatgctggatctggacggacaactgcaggca tga

DBGET integrated database retrieval system