Stenotrophomonas acidaminiphila: AOT14_29070 Help Entry AOT14_29070       CDS       T04107                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism sacz  Stenotrophomonas acidaminiphila Pathway sacz00290   Valine, leucine and isoleucine biosynthesis sacz00650   Butanoate metabolism sacz00660   C5-Branched dibasic acid metabolism sacz00770   Pantothenate and CoA biosynthesis sacz01100   Metabolic pathways sacz01110   Biosynthesis of secondary metabolites sacz01210   2-Oxocarboxylic acid metabolism sacz01230   Biosynthesis of amino acids Module sacz_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine sacz_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:sacz00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     AOT14_29070    00660 C5-Branched dibasic acid metabolism     AOT14_29070   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     AOT14_29070   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     AOT14_29070 Enzymes [BR:sacz01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      AOT14_29070 SSDB OrthologParalogGFIT Motif Pfam:  ACT_5 Motif Other DBs NCBI-ProteinID:  ALJ29260 UniProt:  A0A0R0DTP6 LinkDB All DBs Position 3219901..3220158 Genome browser AA seq 85 aa AA seqDB search MQYRLDLVLTPAEGALLRVLGMVERRGFAPCNIAGSRQPADAGRWHVQLEVSGERPPETL CRQLEKVYDCESVRIVPLEPAGVAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcaataccggcttgacctggtgctgacccccgccgaaggcgcgctgctgcgcgttctg ggcatggtcgagcgccggggcttcgcgccctgcaacatcgccggcagccgccagcccgcc gacgccggccgctggcacgtgcagctggaagtcagcggcgagcgcccgccggagaccctg tgccggcagctggaaaaggtctacgactgcgaatcggtgcggatcgtgccgctggaacct gccggagtggcggcatga

DBGET integrated database retrieval system