Stenotrophomonas acidaminiphila: AOT14_35840 Help Entry AOT14_35840       CDS       T04107                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sacz  Stenotrophomonas acidaminiphila Pathway sacz01100   Metabolic pathways sacz01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sacz00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AOT14_35840    00074 Mycolic acid biosynthesis     AOT14_35840   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AOT14_35840 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PIN Motif Other DBs NCBI-ProteinID:  ALJ29918 UniProt:  A0A0R0DZ69 LinkDB All DBs Position complement(3928385..3928654) Genome browser AA seq 89 aa AA seqDB search MSQQTEAERELAELLVESLNLEDVDPAAIDPEAALFNDGLGLDSIDALELALAIGKRYGF QLRSDNDDNRRIFASLRALSAHVQAHRTT NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcgcaacaaaccgaggccgagcgcgagctggccgaactgctggtcgagagcctgaac ctggaagacgtggatcccgcggcgatcgacccggaggcggcgctgttcaacgacgggctg ggcctggactcgatcgatgcgctggaactggccctggccatcggcaagcgctacggcttc cagttgcgttcggacaacgacgacaaccgccgcatcttcgcctcgctgcgcgcgctgtcg gcgcacgtgcaggcccaccgcaccacctga

DBGET integrated database retrieval system