Shewanella aegiceratis: K0H80_06595 Help Entry K0H80_06595       CDS       T09153                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism saeg  Shewanella aegiceratis Pathway saeg01100   Metabolic pathways saeg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:saeg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     K0H80_06595    00074 Mycolic acid biosynthesis     K0H80_06595   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     K0H80_06595 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QYJ83680 LinkDB All DBs Position complement(1489248..1489481) Genome browser AA seq 77 aa AA seqDB search MNKQEFLNALEEILELDENTLKGDEVLMDIEQWDSLAFLSIIAMADEHFDIVIQGDKLEE INTVGDLVGLVEEHLAA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgaacaaacaagaatttttaaatgccctagaagagatccttgaactggacgagaatacg cttaagggggacgaggtcttgatggacattgagcaatgggactctttggcatttctaagc atcatcgccatggccgatgagcacttcgatatagtgattcaaggtgacaagttagaagag atcaacacagtgggcgatcttgtcggtttagtagaagaacatctagccgcctaa

DBGET integrated database retrieval system