Sphingomonas aerolata: NEF64_12700 Help Entry NEF64_12700       CDS       T08450                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism saer  Sphingomonas aerolata Pathway saer01100   Metabolic pathways saer01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:saer00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NEF64_12700    00074 Mycolic acid biosynthesis     NEF64_12700   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NEF64_12700 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L12_N DUF1493 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  USQ99288 LinkDB All DBs Position complement(2819517..2819753) Genome browser AA seq 78 aa AA seqDB search MSETADRVKKIVVEHLGVEADKVTEDASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKIATVKDAITYIDEHKA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgagaccgcagaccgcgtgaagaagatcgtcgtcgagcatctcggcgtcgaagcc gacaaggtgaccgaagatgcgagcttcatcgacgatctgggtgccgacagcctcgacatc gtcgagctggtcatggcgttcgaagaagaattcggcgtcgagatccctgacgacgcggct gagaagatcgcgaccgtcaaggacgcgatcacctatatcgacgagcacaaggcctga

DBGET integrated database retrieval system