Shewanella aestuarii: HBH39_01390 Help Entry HBH39_01390       CDS       T06921                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism saes  Shewanella aestuarii Pathway saes01100   Metabolic pathways saes01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:saes00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HBH39_01390    00074 Mycolic acid biosynthesis     HBH39_01390   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HBH39_01390 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QIR13305 UniProt:  A0A6G9QGW2 LinkDB All DBs Position PN3F2:complement(272757..273014) Genome browser AA seq 85 aa AA seqDB search MKNLNNEIKELIINCLDLEDITIEDIDTNAPLFGEGLGLDSIDALELGLAIKKQFDIKIE ANSEATKAHFHSVASLASFIESQQV NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaaaaacttaaataatgaaatcaaagaattaattattaattgtttagatcttgaagat ataacaatcgaagatattgacaccaatgcaccacttttcggtgaaggcctaggtttagac tcaattgacgcccttgagcttggtttagcaataaaaaaacaatttgatatcaaaattgaa gctaactcagaagcaactaaagcgcattttcatagcgtagccagtctggcaagttttatt gagtcacagcaagtttag

DBGET integrated database retrieval system