Simiduia agarivorans: M5M_06995 Help Entry M5M_06995         CDS       T02281                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism saga  Simiduia agarivorans Pathway saga01100   Metabolic pathways saga01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:saga00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     M5M_06995    00074 Mycolic acid biosynthesis     M5M_06995   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     M5M_06995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AFU98594 UniProt:  K4KHK0 LinkDB All DBs Position complement(1577224..1577469) Genome browser AA seq 81 aa AA seqDB search MQTKEQVFGSIRTILVDMFELDADAIVLDAHLYDDLDIDSIDAVDMVVELKKMTGKAIQP DDFKAVRTVSDVVDVVHQLVN NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgcagaccaaagagcaggtatttggatccattcgcaccattctcgtggatatgtttgag ctggacgccgacgcgatcgtgctggatgcgcacctttacgacgacctggatatcgattcc attgatgccgtggatatggtggtagagctgaaaaaaatgaccggcaaagccattcagcca gatgattttaaggctgtacgcaccgtgtctgacgtcgtggatgtggttcaccaactggtg aactga

DBGET integrated database retrieval system