Simiduia agarivorans: M5M_15620 Help Entry M5M_15620         CDS       T02281                                  Name (GenBank) methyltransferase   KO K03557   Fis family transcriptional regulator, factor for inversion stimulation protein Organism saga  Simiduia agarivorans Brite KEGG Orthology (KO) [BR:saga00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:saga03000]     M5M_15620    03036 Chromosome and associated proteins [BR:saga03036]     M5M_15620    03400 DNA repair and recombination proteins [BR:saga03400]     M5M_15620 Transcription factors [BR:saga03000]  Prokaryotic type   Helix-turn-helix    Other families     M5M_15620 Chromosome and associated proteins [BR:saga03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     M5M_15620 DNA repair and recombination proteins [BR:saga03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Facilitator       M5M_15620 SSDB OrthologParalogGFIT Motif Pfam:  Fis_N HTH_8 CheZ HTH_30 HTH_50 HTH_28 Xre-like-HTH HTH_23 Cucumo_2B Motif Other DBs NCBI-ProteinID:  AFV00257 UniProt:  K4KML9 LinkDB All DBs Position complement(3393435..3393740) Genome browser AA seq 101 aa AA seqDB search MNTLEPFMAEAPAKETVVDNFSGISANQSLRDCVDQAMENYFRNLDGQPVTNVYDMVMAE VEAPMLEVVLKYTRHNQTKAAQVLGLNRGTLRKKLKQYGLL NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgaatacactggaaccttttatggcagaggcacccgccaaagaaactgtggtagacaat ttctcgggtatcagtgcaaatcaatcactgcgtgattgcgtagaccaggcaatggaaaat tatttccgcaacctggatgggcagcccgtcaccaatgtctacgacatggtgatggctgag gtagaagcgcccatgctggaagtggtgttgaaatatacccgccacaaccagaccaaggcc gctcaggtgctggggctgaaccgtggcaccctgcgcaagaaactgaagcaatacggcctg ctgtaa

DBGET integrated database retrieval system