Simiduia agarivorans: M5M_19050
Help
Entry
M5M_19050 CDS
T02281
Name
(GenBank) GntR family transcriptional regulator
KO
K22104
GntR family transcriptional regulator, sialic acid-inducible nan operon repressor
Organism
saga
Simiduia agarivorans
Brite
KEGG Orthology (KO) [BR:
saga00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03000 Transcription factors [BR:
saga03000
]
M5M_19050
Transcription factors [BR:
saga03000
]
Prokaryotic type
Helix-turn-helix
GntR family
M5M_19050
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
FCD
GntR
HTH_Crp_2
HTH_DeoR
HTH_11
COMM_HN
MarR_2
Rrf2
HTH_17
HTH_36
PaaX
Fe_dep_repress
DUF7769
TrmB
Motif
Other DBs
NCBI-ProteinID:
AFV00939
UniProt:
K4KRZ9
LinkDB
All DBs
Position
4193068..4193802
Genome browser
AA seq
244 aa
AA seq
DB search
MNFPLFDPPPEGVAPLQPRTKKDQLAQKLLEMIYQGLLRHNDTLPSERDLAAMFSVSRET
VRAALASLAEQGLLAVSHGAKTRVLRSETQLQTCARLMPALHSLDIGRYAIEQVFETRQL
IESHIVRLAAARVTPQDIEALQRMLDQQAQLFSEVIHFQLADKAFHQKLADIAGNPLLAR
YAEELYAYGLFFRRELLEGACLVEDSYREHQQIVAAIASGDGDQAAAAMVQHLDSVLALS
AAER
NT seq
735 nt
NT seq
+upstream
nt +downstream
nt
atgaatttccctttgttcgatccgccccccgaaggggtggcgcctttgcaacccaggacc
aagaaagatcagctggcgcaaaagctgctggaaatgatctatcagggtctgctgcgccac
aacgatacattgcccagcgagcgcgacctggccgccatgttttcggtcagccgggaaacg
gtgcgcgcggcgctggcgtcattggcagagcagggcttgctggcggtcagtcatggggca
aaaacccgggtgctgcgctcggaaacccaattgcagacctgcgcccgtctgatgccggcg
ttacacagtctggacatcggccgctatgccattgagcaggtgtttgaaacgcgccagttg
attgaatcgcacattgtgcgtctggcggcggcgcgggtcactccacaagacattgaggca
ctgcagcgcatgctggatcagcaggcgcagctgttctcggaagtcatccacttccagctg
gccgataaagcgtttcatcaaaagctggcggacatcgccggcaatccgttattggcgcgt
tatgcagaagaactctatgcctacggtctgtttttccgccgcgagctgttggaaggggcc
tgtttggtggaagacagttaccgcgagcaccagcagattgttgcggccattgccagtggc
gatggagatcaggcggcggctgccatggttcagcatctggacagcgtattggctctgtct
gccgctgagcgctaa
DBGET
integrated database retrieval system