KEGG   Simiduia agarivorans: M5M_19050
Entry
M5M_19050         CDS       T02281                                 
Name
(GenBank) GntR family transcriptional regulator
  KO
K22104  GntR family transcriptional regulator, sialic acid-inducible nan operon repressor
Organism
saga  Simiduia agarivorans
Brite
KEGG Orthology (KO) [BR:saga00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:saga03000]
    M5M_19050
Transcription factors [BR:saga03000]
 Prokaryotic type
  Helix-turn-helix
   GntR family
    M5M_19050
SSDB
Motif
Pfam: FCD GntR HTH_Crp_2 HTH_DeoR HTH_11 COMM_HN MarR_2 Rrf2 HTH_17 HTH_36 PaaX Fe_dep_repress DUF7769 TrmB
Other DBs
NCBI-ProteinID: AFV00939
UniProt: K4KRZ9
LinkDB
Position
4193068..4193802
AA seq 244 aa
MNFPLFDPPPEGVAPLQPRTKKDQLAQKLLEMIYQGLLRHNDTLPSERDLAAMFSVSRET
VRAALASLAEQGLLAVSHGAKTRVLRSETQLQTCARLMPALHSLDIGRYAIEQVFETRQL
IESHIVRLAAARVTPQDIEALQRMLDQQAQLFSEVIHFQLADKAFHQKLADIAGNPLLAR
YAEELYAYGLFFRRELLEGACLVEDSYREHQQIVAAIASGDGDQAAAAMVQHLDSVLALS
AAER
NT seq 735 nt   +upstreamnt  +downstreamnt
atgaatttccctttgttcgatccgccccccgaaggggtggcgcctttgcaacccaggacc
aagaaagatcagctggcgcaaaagctgctggaaatgatctatcagggtctgctgcgccac
aacgatacattgcccagcgagcgcgacctggccgccatgttttcggtcagccgggaaacg
gtgcgcgcggcgctggcgtcattggcagagcagggcttgctggcggtcagtcatggggca
aaaacccgggtgctgcgctcggaaacccaattgcagacctgcgcccgtctgatgccggcg
ttacacagtctggacatcggccgctatgccattgagcaggtgtttgaaacgcgccagttg
attgaatcgcacattgtgcgtctggcggcggcgcgggtcactccacaagacattgaggca
ctgcagcgcatgctggatcagcaggcgcagctgttctcggaagtcatccacttccagctg
gccgataaagcgtttcatcaaaagctggcggacatcgccggcaatccgttattggcgcgt
tatgcagaagaactctatgcctacggtctgtttttccgccgcgagctgttggaaggggcc
tgtttggtggaagacagttaccgcgagcaccagcagattgttgcggccattgccagtggc
gatggagatcaggcggcggctgccatggttcagcatctggacagcgtattggctctgtct
gccgctgagcgctaa

DBGET integrated database retrieval system