Sagittula sp. MA-2: QNI11_21540
Help
Entry
QNI11_21540 CDS
T11138
Name
(GenBank) FliI/YscN family ATPase
KO
K02412
flagellum-specific ATP synthase [EC:
7.4.2.8
]
Organism
sagz Sagittula sp. MA-2
Pathway
sagz02040
Flagellar assembly
Brite
KEGG Orthology (KO) [BR:
sagz00001
]
09140 Cellular Processes
09142 Cell motility
02040 Flagellar assembly
QNI11_21540
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
02044 Secretion system [BR:
sagz02044
]
QNI11_21540
02035 Bacterial motility proteins [BR:
sagz02035
]
QNI11_21540
Enzymes [BR:
sagz01000
]
7. Translocases
7.4 Catalysing the translocation of amino acids and peptides
7.4.2 Linked to the hydrolysis of a nucleoside triphosphate
7.4.2.8 protein-secreting ATPase
QNI11_21540
Secretion system [BR:
sagz02044
]
Type III secretion system
Flagellar export apparatus
QNI11_21540
Bacterial motility proteins [BR:
sagz02035
]
Flagellar system
Flagellar assembly proteins
Type-III secretion
QNI11_21540
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ATP-synt_ab
T3SS_ATPase_C
RsgA_GTPase
ABC_tran
Motif
Other DBs
NCBI-ProteinID:
WHZ35195
LinkDB
All DBs
Position
4413739..4415112
Genome browser
AA seq
457 aa
AA seq
DB search
MDEEISGLRARIAQMQPVRDVGRVQAVDGTTIWVSGLSEVASIGDRLRLYHGAHTLGGEV
LRIRNDLVAMLPDEVAEGVSKGDRVAVLGPPTLAPCNSWIGRVVDAYGRPLDGAPLGPGQ
KRRPFRASPPPAAARRRLGPRLSTGLSVFDTLLPIAQGQRIGLFAGSGVGKSRLLAQLAQ
GMQADVVVLALVGERGREVLDFVTKVLGPEGMKRSIVVAATSDRSPLERRRCPLAAMTIA
EHFRDQGKHVLYMADSITRFAEAHREVAIASGELPALRGHPPSVAHQIMRLAERAGCGVE
GSGDITAVLSVLVAGSDMEEPIADILRGVLDGHVVLDRQIAERGRFPAIDLLRSVSRSLP
EAANELENVLIQDVRQLLGSYARSETMIRAGLYREGEDPILDQAVRAWSDLDDFLSEPSP
AGPERAFQRLELILRRSQSAKPRRPAPQRGRPGLQAR
NT seq
1374 nt
NT seq
+upstream
nt +downstream
nt
atggatgaagagatcagcggcctgcgtgcccggatcgcgcagatgcagcccgtgcgcgac
gtgggcagggtccaggcggtcgacggcacgacgatctgggtcagcggcctgtcagaagtg
gcgagcatcggcgaccggctgcgcctgtatcacggtgcccatacacttggcggagaggtc
ctgcgcatccggaacgaccttgtcgccatgctgccggacgaggtcgccgaaggcgtgtcc
aagggcgaccgggtggcggtgctggggccgccgacccttgcgccctgcaacagctggatc
ggtcgggtcgttgacgcctacggtcgccccctggacggcgcgccgctaggtccagggcaa
aagcgacggcccttccgggcaagcccgccgcctgccgccgcgcgtcgccgccttggcccg
cgcctgtccaccggcctgtcggtcttcgacacgctcttgcccatcgcgcagggccagagg
atcggtctttttgcgggatcgggcgtcgggaaatcacgccttctcgcgcagctcgctcag
ggcatgcaggcggacgtggtcgtccttgcgcttgtcggtgaacgaggccgcgaggttctc
gatttcgtgaccaaggtgctcggcccggaagggatgaagcgcagtatcgttgtcgccgcg
acgtccgaccgttcgccgctggaacggcgccgttgcccgctggccgccatgacgattgcc
gagcattttcgcgatcagggcaagcacgtcctctacatggccgattcgatcacgcgcttc
gccgaggcgcatcgcgaggtggccattgcctccggcgaattgccggcgctgcgtggccac
cccccgtcagtggcgcaccagatcatgcgacttgccgaaagggcaggatgcggtgtcgag
ggttcgggggacatcaccgccgtcctcagcgtgcttgtcgccggatcggacatggaagag
ccgatcgccgatatcctgcggggtgttctcgacgggcatgtggtgctggatcgccagatc
gccgaacgcggccggtttcccgcaatagaccttttgcgctccgtctcccgaagtctgccc
gaagcggcgaacgaactggaaaacgtgctgattcaggatgtgcggcaacttctgggatca
tacgcccggtcggaaaccatgatccgtgccgggttgtatcgggagggggaggatccgatc
ctcgatcaggcggtccgggcgtggtcggacctcgacgatttcctgtcggagccatcgccg
gcagggccggaacgcgcgtttcaacggctggagctgatcctgcgccgatcccagtccgcc
aagccgcggcgacctgcaccgcaacgaggccgcccgggtctgcaagcccgttag
DBGET
integrated database retrieval system