Sulfolobales archaeon HS-7: HS7_06570 Help Entry HS7_06570         CDS       T08110                                  Name (GenBank) 30S ribosomal protein S27   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism sahs  Sulfolobales archaeon HS-7 Pathway sahs03010   Ribosome Brite KEGG Orthology (KO) [BR:sahs00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     HS7_06570   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     HS7_06570  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:sahs03011]     HS7_06570    04121 Ubiquitin system [BR:sahs04121]     HS7_06570   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:sahs04147]     HS7_06570 Ribosome [BR:sahs03011]  Ribosomal proteins   Eukaryotes    Small subunit     HS7_06570   Archaea     HS7_06570 Ubiquitin system [BR:sahs04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    HS7_06570 Exosome [BR:sahs04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    HS7_06570   Exosomal proteins of colorectal cancer cells    HS7_06570 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_IS1595 Cas12f1-like_TNB YhfH TackOD1 zf_UBZ Auto_anti-p27 Motif Other DBs NCBI-ProteinID:  BCU67220 LinkDB All DBs Position complement(688196..688375) Genome browser AA seq 59 aa AA seqDB search MSKGKTTIVSYYEISSKGVKLKNKKCPRCGSVMAHHMKPVERWTCGKCYYTEFIGKKGR NT seq 180 nt NT seq  +upstreamnt  +downstreamnt atgagtaagggtaaaaccacgatagtatcatattatgagatttcttcaaaaggtgttaag cttaagaataagaaatgtccgaggtgtgggagcgttatggctcatcacatgaagcccgtt gagaggtggacttgcgggaagtgctattacactgagttcatcggaaagaagggcaggtaa

DBGET integrated database retrieval system