Salinarchaeum sp. IM2453: K0C01_04510 Help Entry K0C01_04510       CDS       T07444                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism saim  Salinarchaeum sp. IM2453 Pathway saim03010   Ribosome Brite KEGG Orthology (KO) [BR:saim00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     K0C01_04510   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     K0C01_04510  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:saim03011]     K0C01_04510    04121 Ubiquitin system [BR:saim04121]     K0C01_04510   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:saim04147]     K0C01_04510 Ribosome [BR:saim03011]  Ribosomal proteins   Eukaryotes    Small subunit     K0C01_04510   Archaea     K0C01_04510 Ubiquitin system [BR:saim04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    K0C01_04510 Exosome [BR:saim04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    K0C01_04510   Exosomal proteins of colorectal cancer cells    K0C01_04510 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 FYVE Ribosomal_L37e Rcat_RNF216 DZR Auto_anti-p27 Zn_ribbon_RPB9 Motif Other DBs NCBI-ProteinID:  QZA89406 LinkDB All DBs Position complement(959336..959470) Genome browser AA seq 44 aa AA seqDB search MTRHELFTDDGDVTNDPCPRCDNSYLANHDDRKHCGNCGYTEWT NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atgacgcggcatgaactctttaccgacgatggcgatgtgaccaacgatccgtgcccacgt tgcgataattcctaccttgctaatcacgacgatcgcaagcactgtggaaactgcggatat actgaatggacgtag

DBGET integrated database retrieval system