Spiractinospora alimapuensis: J4H86_10120 Help Entry J4H86_10120       CDS       T07850                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism saiu  Spiractinospora alimapuensis Brite KEGG Orthology (KO) [BR:saiu00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     J4H86_10120 Enzymes [BR:saiu01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      J4H86_10120 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like Thioredoxin_2 GST_N_2 Thioredoxin GST_N_3 Thioredoxin_9 BFA1_C Motif Other DBs NCBI-ProteinID:  QVQ54019 LinkDB All DBs Position 2234412..2234663 Genome browser AA seq 83 aa AA seqDB search MTSTPEIIMYTTPWCGFCRRLKSQLAREGVELTEVDIEQDPTAAETVMRLNGGNQTVPTV VFPDGTAMTNPPAAKILEKIAGN NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgacgtccacaccggagatcatcatgtacaccacaccgtggtgtggattctgccgacgg ctgaagagccagctcgcccgcgagggtgtggaactcaccgaggtcgacatcgaacaggat ccgacggcggcagagaccgtcatgcgtctcaacggcgggaaccagacggtaccgacggtg gtcttccccgacgggacggcgatgacgaatccgccggccgcgaagatcctggagaagatc gccggcaattga

DBGET integrated database retrieval system