Sphingopyxis alaskensis: Sala_0280 Help Entry Sala_0280         CDS       T00361                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sal  Sphingopyxis alaskensis Pathway sal01100   Metabolic pathways sal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sal00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Sala_0280    00074 Mycolic acid biosynthesis     Sala_0280   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Sala_0280 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  ABF52003 UniProt:  Q1GWG9 LinkDB All DBs Position 278152..278388 Genome browser AA seq 78 aa AA seqDB search MSDSAEKVKKIVVEHLGVEADKVTEEASFIDDLGADSLDIVELVMAFEEEFGVEIPDDAA EKIATVKDAIDYIEANKG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcgattcggccgaaaaggttaaaaagatcgtcgtcgaacatctgggcgtcgaagcc gacaaggtcaccgaggaagcgagcttcatcgacgatctgggcgccgacagcctcgacatc gtcgaactggtgatggcgttcgaggaagagttcggcgtcgaaatccccgacgatgcggcg gaaaagatcgccaccgtcaaggatgcgatcgactatatcgaagcgaacaagggctaa

DBGET integrated database retrieval system