Sphingopyxis alaskensis: Sala_2170 Help Entry Sala_2170         CDS       T00361                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism sal  Sphingopyxis alaskensis Pathway sal01100   Metabolic pathways sal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sal00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Sala_2170    00074 Mycolic acid biosynthesis     Sala_2170   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Sala_2170 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 SPATA9 Motif Other DBs NCBI-ProteinID:  ABF53879 UniProt:  Q1GR43 LinkDB All DBs Position 2279593..2279829 Genome browser AA seq 78 aa AA seqDB search MSTALTDQIYGLIAPFNKKGIALTDATTFAGDLEWDSLTVMDFVAEVEDTFDIIISMNQQ AEIENVGQLVAAVEKLQG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccgccctgaccgaccagatttacggcctgatcgccccgttcaacaaaaagggc atcgcgctgaccgacgcgacgacctttgccggcgacctggaatgggacagcctgacggtg atggacttcgtcgccgaggtcgaagacacgttcgacatcatcatcagcatgaaccagcag gccgagatagagaatgtcggccagctggtcgcggcggtggaaaaactgcagggctga

DBGET integrated database retrieval system