KEGG   Salinibacterium sp. UTAS2018: ESZ53_00880
Entry
ESZ53_00880       CDS       T05816                                 
Name
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sala  Salinibacterium sp. UTAS2018
Pathway
sala00260  Glycine, serine and threonine metabolism
sala00750  Vitamin B6 metabolism
sala01100  Metabolic pathways
sala01110  Biosynthesis of secondary metabolites
sala01120  Microbial metabolism in diverse environments
sala01230  Biosynthesis of amino acids
Module
sala_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sala00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ESZ53_00880
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ESZ53_00880
Enzymes [BR:sala01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ESZ53_00880
SSDB
Motif
Pfam: PALP Asparaginase_C
Other DBs
NCBI-ProteinID: QAV69120
LinkDB
Position
complement(181669..182760)
AA seq 363 aa
MNSEIRNRQWRGLLHEYADRLNISDATPIITLGEGGTPLIPAPALSARTGAKVWVKFEGM
NPTGSFKDRGMTMAISKAVEHGAKAVICASTGNTSASAAAYAAHAGITAAVLVPEGKIAM
GKLSQAIAHNGELIQVQGNFDDCLDIARDLADNYPVHLVNSVNPDRIEGQKTAAFEVVEV
LGDAPDFHIVPVGNAGNYTAYFRGYSEELERSATTKLPRMFGFQAEGSAPIVRGEVVKNP
DTIASAIRIGNPASWHLATEAHKVSNGYFGAISDAKILEAQRILSAEVGIFVEPASAISV
AGLLERAEAGQIPRGSTVVLTVTGHGLKDPQWALKTASGDDITPKVVPVDTAEVASVLGL
AKA
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgaatagcgaaatccggaaccgccagtggcgcggtctgcttcacgagtacgccgaccgt
ctcaacatttctgacgcgacccccatcatcacgctgggagagggcggaactcctctgatt
cccgcaccagcgctgtcggctcgcaccggcgctaaggtctgggtcaagttcgaaggaatg
aaccccacgggctcgttcaaagaccgcggcatgacaatggccatctcgaaggctgttgag
cacggcgccaaggccgttatctgcgcctcgaccggtaacacttcggcttcggcggctgcg
tacgctgcgcacgcgggaatcaccgctgctgttctcgtgcccgagggaaagatcgcgatg
ggcaagctcagccaggccatcgctcacaacggtgaactcatccaggttcagggaaacttc
gacgattgcctcgacatcgctcgcgacctcgccgacaactacccggtgcacctcgtcaac
tcggtgaaccctgaccgtatcgaaggccagaagactgccgctttcgaggtcgtcgaagtt
ctgggcgacgcccctgacttccacattgttcccgtcggaaacgcgggaaactacaccgct
tacttccggggctacagcgaagagctagagcgctccgccaccaccaagctgccccgcatg
ttcggtttccaggccgagggcagtgctccgatcgttcgcggcgaagtcgttaagaacccc
gacacaattgccagcgctatccgcatcggaaaccccgcatcgtggcacctcgccacggag
gcccacaaagtgtcgaatggctacttcggcgccatcagcgacgccaagatcctcgaagct
cagcgcatcctctcggctgaagttggcattttcgtcgagcccgcctccgccatcagcgtt
gccggacttctcgagcgtgccgaagctggtcagattcctcgtggttccaccgttgtgctc
acggttaccggccatggtcttaaggacccgcagtgggcgcttaagacggctagcggtgat
gacatcacgccgaaggttgttcccgtcgacaccgctgaggtcgcaagcgtgctggggctg
gccaaggcatga

DBGET integrated database retrieval system