Salinibacterium sp. UTAS2018: ESZ53_09375 Help Entry ESZ53_09375       CDS       T05816                                  Name (GenBank) DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism sala  Salinibacterium sp. UTAS2018 Brite KEGG Orthology (KO) [BR:sala00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:sala03032]     ESZ53_09375    03036 Chromosome and associated proteins [BR:sala03036]     ESZ53_09375    03400 DNA repair and recombination proteins [BR:sala03400]     ESZ53_09375 DNA replication proteins [BR:sala03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     ESZ53_09375 Chromosome and associated proteins [BR:sala03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     ESZ53_09375 DNA repair and recombination proteins [BR:sala03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       ESZ53_09375 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding DUF2267 HU-HIG HU-CCDC81_euk_2 PSF3_N Motif Other DBs NCBI-ProteinID:  QAV70628 UniProt:  A0A410YJJ4 LinkDB All DBs Position complement(1974677..1974967) Genome browser AA seq 96 aa AA seqDB search MADKSLNRTEFVAAVAAESGQSQAAVSGVVDAFFSVLSKSVGEGTKVSIPGWMAAERTFR EARTGRNPQTGEAIEIKASHGVKLSAGSKLKAAAKG NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atggctgacaagtcgctaaaccgtactgaattcgtagcggcggttgccgcagagtctggc cagagccaggctgccgtttccggcgtcgttgacgctttcttctccgtgctgtccaagtcg gtcggcgaaggaaccaaggtttcgatccccggatggatggctgcagagcgtaccttccgc gaggctcgtaccggccgtaacccgcagacgggtgaagccatcgagatcaaggccagccac ggcgtcaagctcagtgcaggcagcaagctcaaggcagcagccaagggctaa

DBGET integrated database retrieval system