KEGG   Homoserinimonas hongtaonis: C2138_04215
Entry
C2138_04215       CDS       T05414                                 
Name
(GenBank) pyridoxal-5'-phosphate-dependent protein subunit beta
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
salc  Homoserinimonas hongtaonis
Pathway
salc00260  Glycine, serine and threonine metabolism
salc00750  Vitamin B6 metabolism
salc01100  Metabolic pathways
salc01110  Biosynthesis of secondary metabolites
salc01120  Microbial metabolism in diverse environments
salc01230  Biosynthesis of amino acids
Module
salc_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:salc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    C2138_04215
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    C2138_04215
Enzymes [BR:salc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     C2138_04215
SSDB
Motif
Pfam: PALP ACP_syn_III_C
Other DBs
NCBI-ProteinID: AWB88858
LinkDB
Position
complement(867014..868132)
AA seq 372 aa
MSSYLVGRDGHRYPIDEPRWRGDDGSPLLVGPLDGIGPDGIDYSIRSQWRYAAALPLDLA
PVSLGEGCTPLLETTLGGTPLLVKPEWFNPTGSFKDRGTAVMMAMLAAQGIDHILEDSSG
NGGASVAAYAAAAGIRATILAPESTSPAKLIQSRAHGATVDLVAGSRQATADEAIRRSGD
IFYASHNWHPFFVQGVSLLAYEMWEDLGFEAPDAVILPAGAGSLVLGCSIGFGQLLRAGM
IERMPRLLVVQPENCSPLVRAFAAGEHAVRQADWSPTLAEGTSIARPVRDREVLAAIRES
QGCLVAVAEASIIPSVRELASRGLYAEPTSAIVAAAVPEFVARGAIRPGDSVVAVLTGSG
LKATGALQKLLA
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgtcgtcatacctcgtcgggcgcgacggacaccgctaccccatcgacgagcctcgatgg
cgcggagacgacggatcacccctgctcgtgggaccgctcgacggaatcgggccagacggc
atcgactacagcatccgctcgcagtggcgttatgccgcagccctgccgctcgaccttgct
cccgtctcgttgggagagggatgcactcccctgctggagacgacgctgggcggcactccc
ctgctggtcaaaccggagtggttcaacccgacggggagcttcaaagaccgcggaaccgcc
gtgatgatggccatgctcgccgcccaagggattgaccacattctggaagacagcagtgga
aacggcggcgcgtccgtggccgcttatgctgccgccgcgggcatccgtgccacgatcctt
gccccagagtcgacctcgccggccaagctcatccagagccgggcgcacggggcaaccgtc
gacctcgtcgcaggctcgcgccaggccaccgctgacgaagccattcgccgctccggtgac
attttttatgccagccacaactggcatccgttctttgtgcagggtgtttcgctgctggcc
tacgagatgtgggaagacctgggcttcgaggcgccggatgcggtgattctgcccgcggga
gccggaagcctcgtgctcggttgctccatcggcttcgggcagttgctgcgcgccggcatg
atcgagcggatgccgcgcttgctcgtcgtgcagcccgagaactgcagcccgctcgtgcgc
gcattcgctgcgggcgagcacgccgtgcggcaggccgactggtcgccgaccctggccgaa
ggcacctcaatcgcgcggccagtgcgcgaccgtgaggtgctcgccgcgatccgggaatcg
caagggtgccttgtggccgttgccgaggcgagcatcattccctccgtgcgagagcttgcg
tcccgcggtctctatgctgagccgacgagcgcgattgtcgcggctgcggtgcccgaattc
gtagcgcggggagccatccgcccgggcgattcggtcgtcgctgtgctcacaggctcgggt
ctcaaagccacgggcgccctgcagaagctgctcgcataa

DBGET integrated database retrieval system