Streptomyces alboflavus: SMD44_00408 Help Entry SMD44_00408       CDS       T05221                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism salf  Streptomyces alboflavus Pathway salf00998   Biosynthesis of various antibiotics salf01100   Metabolic pathways salf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:salf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SMD44_00408 (acpP)    00074 Mycolic acid biosynthesis     SMD44_00408 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SMD44_00408 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 Motif Other DBs NCBI-ProteinID:  ARX81010 UniProt:  A0A1Z1W3L8 LinkDB All DBs Position 414569..414799 Genome browser AA seq 76 aa AA seqDB search MYETVKTLLTQEFDISEDQIAPESTLEDLGLDSLASVEFALALEKGLGVEISDDEVVELE RLDKILELVERRKRAS NT seq 231 nt NT seq  +upstreamnt  +downstreamnt gtgtacgaaacggtcaagaccctgctcacccaggaattcgacatctccgaggatcagatc gccccggagtccacgctggaggacctgggcctggactccctggcctcggtcgagttcgcg ctcgccctggagaagggtctcggcgtggagatctcggacgacgaggtggtggagctggag cggctcgacaagatcctggaactcgtcgagcgccgcaagcgcgcgtcctga

DBGET integrated database retrieval system