Streptomyces alboflavus: SMD44_02636 Help Entry SMD44_02636       CDS       T05221                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism salf  Streptomyces alboflavus Pathway salf00998   Biosynthesis of various antibiotics salf01100   Metabolic pathways salf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:salf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SMD44_02636 (acpP)    00074 Mycolic acid biosynthesis     SMD44_02636 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SMD44_02636 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ARX83221 UniProt:  A0A1Z1W9U7 LinkDB All DBs Position 2851724..2851972 Genome browser AA seq 82 aa AA seqDB search MAATEKEIVDGLAEIVNEIAGIPVEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DDDVKNLKTVGDATKYILEHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccactgagaaggagatcgtcgacggtctcgccgagatcgtcaacgagatcgcc ggcatcccggtcgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgac tcgctgtccatggtcgaggtcgtcgtcgccgccgaagagcgcttcgacgtcaagatcccg gacgacgacgtcaagaacctgaagaccgtcggcgacgcgacgaagtacatcctcgagcac caggcctga

DBGET integrated database retrieval system