Streptomyces alboflavus: SMD44_05526 Help Entry SMD44_05526       CDS       T05221                                  Name (GenBank) hypothetical protein   KO K27095   acyl-CoA carboxylase epsilon subunit Organism salf  Streptomyces alboflavus Pathway salf00074   Mycolic acid biosynthesis salf00280   Valine, leucine and isoleucine degradation salf00630   Glyoxylate and dicarboxylate metabolism salf00640   Propanoate metabolism salf01100   Metabolic pathways salf01110   Biosynthesis of secondary metabolites salf01120   Microbial metabolism in diverse environments salf01200   Carbon metabolism Module salf_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA Brite KEGG Orthology (KO) [BR:salf00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     SMD44_05526    00640 Propanoate metabolism     SMD44_05526   09103 Lipid metabolism    00074 Mycolic acid biosynthesis     SMD44_05526   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     SMD44_05526 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACC_epsilon Motif Other DBs NCBI-ProteinID:  ARX86057 UniProt:  A0A1Z1WHY7 LinkDB All DBs Position complement(5995124..5995330) Genome browser AA seq 68 aa AA seqDB search MIKVVRGNPTPEELAAALAVVQARAAAAAQAPSGAPPVPAAWADPARVARERMPAPGAAA WSRTYWPG NT seq 207 nt NT seq  +upstreamnt  +downstreamnt gtgatcaaggtcgtacggggcaatcccacccctgaggagctggccgccgccctggcggtg gtccaggcgcgcgccgcggcggcagcgcaggcgccgtccggcgcgcccccggtcccggcc gcctgggcggacccggcgcgggtggcccgggagcggatgcccgcaccgggcgcggcggcg tggagccgcacgtactggccggggtga

DBGET integrated database retrieval system