Shewanella algae: BS332_05645 Help Entry BS332_05645       CDS       T05622                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism salg  Shewanella algae Pathway salg01100   Metabolic pathways salg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:salg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BS332_05645    00074 Mycolic acid biosynthesis     BS332_05645   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BS332_05645 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding CagD Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AXQ13867 UniProt:  A0A1S2TUX9 LinkDB All DBs Position 1265764..1266012 Genome browser AA seq 82 aa AA seqDB search MQSREQILEMLSKILVDEFEVDAEAITPEASLYEELDLDSIDAVDLVIKLQQLTGKKIQP DEFKSVRTVNDVVNAIEGLVKD NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcaaagccgtgaacagatattggaaatgctgagcaagatcctggtcgatgagtttgaa gtggatgccgaggcgataacccctgaggcatccctctatgaagagctggatctggacagc attgatgcggtagatctggtgatcaaattgcaacagctgaccggcaaaaagatccagccc gatgaattcaagtcggtacggacggtcaacgacgtggttaacgccatcgagggactggtt aaagactga

DBGET integrated database retrieval system