Shewanella algae: BS332_10165 Help Entry BS332_10165       CDS       T05622                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism salg  Shewanella algae Brite KEGG Orthology (KO) [BR:salg00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:salg03032]     BS332_10165    03036 Chromosome and associated proteins [BR:salg03036]     BS332_10165    03400 DNA repair and recombination proteins [BR:salg03400]     BS332_10165 DNA replication proteins [BR:salg03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     BS332_10165 Chromosome and associated proteins [BR:salg03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     BS332_10165 DNA repair and recombination proteins [BR:salg03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       BS332_10165 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF3791 TFIIB HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  AXQ14601 UniProt:  A0A2T3H7K6 LinkDB All DBs Position complement(2230232..2230504) Genome browser AA seq 90 aa AA seqDB search MNKTELIAKMAEHANLSKAEAARALKSFEVAVTDAMKEGTKISIVGFGSFETSTRAARTG RNPQTGKEIQIPAATIPKFKAGKALRDSVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaactgaactgatcgctaaaatggcagaacacgccaacctgtccaaggcagaa gctgcccgcgcactcaagtcgttcgaagtagcagtgaccgatgccatgaaagaaggaact aaaatctccatcgtaggctttggctctttcgaaacttcaacccgtgcagcccgcactggt cgtaacccgcaaaccggtaaagagatccaaatccctgccgccactattcccaagttcaag gccggcaaggcactgcgtgacagcgtcaactaa

DBGET integrated database retrieval system