Streptomyces albireticuli: SMD11_0677 Help Entry SMD11_0677        CDS       T05230                                  Symbol actI3 Name (GenBank) Acyl carrier protein   KO K05553   minimal PKS acyl carrier protein Organism salj  Streptomyces albireticuli Pathway salj00253   Tetracycline biosynthesis salj01056   Biosynthesis of type II polyketide backbone salj01100   Metabolic pathways salj01110   Biosynthesis of secondary metabolites Module salj_M00778   Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide Brite KEGG Orthology (KO) [BR:salj00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    01056 Biosynthesis of type II polyketide backbone     SMD11_0677 (actI3)    00253 Tetracycline biosynthesis     SMD11_0677 (actI3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01004 Lipid biosynthesis proteins [BR:salj01004]     SMD11_0677 (actI3)    01008 Polyketide biosynthesis proteins [BR:salj01008]     SMD11_0677 (actI3) Lipid biosynthesis proteins [BR:salj01004]  Polyketide synthase   Component type    SMD11_0677 (actI3) Polyketide biosynthesis proteins [BR:salj01008]  Polyketide synthase (PKS)   Type II PKS    C7-C14 cyclized polyketide type     Octaketide PKS      SMD11_0677 (actI3)     Nonaketide PKS      SMD11_0677 (actI3)     Decaketide PKS      SMD11_0677 (actI3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ARZ66343 UniProt:  A0A1Z2KWC5 LinkDB All DBs Position 760966..761229 Genome browser AA seq 87 aa AA seqDB search MTNTTMTLDDLHRILAVCGGASESWPAGEDVHDRPFEELGYDSLALLEAAVRIENEFGVQ VPDEVIPQLTSPRDVLDLVNGPTAKTV NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgacgaacaccaccatgaccctcgacgatctgcaccgcatcctggccgtctgcgggggc gcgagcgagtcctggccggcgggcgaggacgtgcacgaccggcccttcgaggagctcggc tacgactccctcgccctgctggaggccgccgtgcgcatcgagaacgagttcggcgtgcag gtgccggacgaggtgatcccgcagctcaccagcccgcgcgacgtactcgacctggtcaac ggccccaccgcgaagaccgtgtga

DBGET integrated database retrieval system