Streptomyces albireticuli: SMD11_2362 Help Entry SMD11_2362        CDS       T05230                                  Name (GenBank) glutaredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism salj  Streptomyces albireticuli Brite KEGG Orthology (KO) [BR:salj00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     SMD11_2362 Enzymes [BR:salj01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      SMD11_2362 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 Glrx-like Thioredoxin GST_N_3 Motif Other DBs NCBI-ProteinID:  ARZ68011 UniProt:  A0A1Z2L1B4 LinkDB All DBs Position 2773811..2774068 Genome browser AA seq 85 aa AA seqDB search MSGTVTMYSTTWCGYCRRLKSQLDREGIAYNEINIEHDAESAAFVEKANDGNQTVPTVLV TPVGGGASVTMTNPSLAQVKQALAS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgtcgggcaccgtgacgatgtacagcacgacctggtgcggttactgccggcggctgaag agccagctggaccgcgaggggatcgcgtacaacgagatcaacatcgagcacgacgccgag tcggcggccttcgtcgagaaggcgaacgacggcaaccagacggtcccgacggtcctggtg accccggtgggcggcggcgcctcggtcacgatgaccaacccgtccctggcccaggtcaag caggcgctcgcgtcctga

DBGET integrated database retrieval system