Streptomyces albireticuli: SMD11_4702 Help Entry SMD11_4702        CDS       T05230                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism salj  Streptomyces albireticuli Pathway salj00998   Biosynthesis of various antibiotics salj01100   Metabolic pathways salj01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:salj00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     SMD11_4702 (acpP)    00074 Mycolic acid biosynthesis     SMD11_4702 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     SMD11_4702 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ARZ70296 UniProt:  A0A1Z2L7K6 LinkDB All DBs Position complement(5367589..5367834) Genome browser AA seq 81 aa AA seqDB search MATQEEIVKGFAEIVNEIAGIPVEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIPD EDVKNLKTVGDAAEYILKNQG NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggccacccaggaagagatcgtcaagggtttcgccgagatcgtcaacgagatcgccggc atcccggtcgaggacgtccagctggacaagtccttcaccgacgacctggacgtcgactcg ctgtccatggtcgaggtcgtcgtcgccgctgaggagcgcttcgacgtcaagatccccgac gaggacgtcaagaacctgaagacggtcggcgacgccgccgagtacatcctcaagaaccag ggctga

DBGET integrated database retrieval system