Streptomyces noursei ZPM: SAZ_28280 Help Entry SAZ_28280         CDS       T03896                                  Name (GenBank) glutaredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism sall  Streptomyces noursei ZPM Brite KEGG Orthology (KO) [BR:sall00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     SAZ_28280 Enzymes [BR:sall01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      SAZ_28280 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin_2 GST_N_2 GST_N_3 Thioredoxin Glrx-like IU_nuc_hydro Ank_KRIT1 Motif Other DBs NCBI-ProteinID:  AKA05904 LinkDB All DBs Position complement(6391575..6391820) Genome browser AA seq 81 aa AA seqDB search MAGTVTMYSTTWCGYCRRLKGQMDREGIAYTEVNIEQDPESAAFVEKANGGNQTVPTVLF ADGTTLTNPSLAQVKEKVAAA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcgggcactgtgacgatgtacagcacgacctggtgcggttactgccgtcggctgaag ggccagatggaccgcgagggcattgcgtacaccgaggtcaacatcgagcaggacccggag tccgcggcgttcgtcgagaaggccaacggcggcaaccagacggtgccgaccgtgctcttc gccgacggcacgacgctgaccaacccgtccctggcgcaggtcaaggagaaggtggccgcg gcctga

DBGET integrated database retrieval system