Salinimonas sediminis: D0Y50_13285 Help Entry D0Y50_13285       CDS       T05624                                  Name (GenBank) DNA-binding protein HU-beta   KO K03530   DNA-binding protein HU-beta Organism salm  Salinimonas sediminis Brite KEGG Orthology (KO) [BR:salm00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:salm03032]     D0Y50_13285    03036 Chromosome and associated proteins [BR:salm03036]     D0Y50_13285    03400 DNA repair and recombination proteins [BR:salm03400]     D0Y50_13285 DNA replication proteins [BR:salm03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     D0Y50_13285 Chromosome and associated proteins [BR:salm03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     D0Y50_13285 DNA repair and recombination proteins [BR:salm03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       D0Y50_13285 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HVO_A0261_N HU-DNA_bdg HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  AXR07236 UniProt:  A0A346NNX9 LinkDB All DBs Position complement(2992437..2992709) Genome browser AA seq 90 aa AA seqDB search MNKSQLIDQIAAGADISKAAAGRALDAFTDAVTAALKDGDQVALVGFGTFAVRERSARSG RNPQTGETIQIAAAKVPSFKAGKALKDACN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt gtgaacaagtctcaactcatcgaccaaatcgctgctggtgcggacatctctaaagcggct gcaggccgagctcttgacgcattcactgatgcagttacagcagcgcttaaagacggtgac caagtggcactggtaggttttggtactttcgcagttcgtgagcgctctgctcgcagcggc cgtaaccctcagactggtgagactattcagattgcagcagcaaaagttccatctttcaaa gcgggtaaagctctgaaagacgcgtgcaactaa

DBGET integrated database retrieval system